Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
Protein automated matches [190524] (2 species) not a true protein |
Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (11 PDB entries) |
Domain d6hwrc2: 6hwr C:121-431 [367112] Other proteins in same PDB: d6hwra1, d6hwrb1, d6hwrc1, d6hwrd1 automated match to d1kbpa2 complexed with edo, fe, gol, h1q, h1t, h1w, ipa, na, nag, pge, so4, vn3, vv6, zn |
PDB Entry: 6hwr (more details), 1.95 Å
SCOPe Domain Sequences for d6hwrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hwrc2 d.159.1.1 (C:121-431) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf fnrhwypvdds
Timeline for d6hwrc2: