SCOPe 2.08: Domain d6hwrc1: 6hwr C:9-120

Lineage for d6hwrc1 (6hwr C:9-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.0: automated matches [227279] (1 protein)
   not a true family

6. Protein automated matches [227090] (1 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (11 PDB entries)

8. Domain d6hwrc1: 6hwr C:9-120 [367111]
   Other proteins in same PDB: d6hwra2, d6hwrb2, d6hwrc2, d6hwrd2
   automated match to d1kbpa1
   complexed with edo, fe, gol, h1q, h1t, h1w, ipa, na, nag, pge, so4, vn3, vv6, zn

Details for d6hwrc1

PDB Entry: 6hwr, 1.95 Å

PDB Description: red kidney bean purple acid phosphatase in complex with adenosine divanadate

PDB Compounds: (C:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6hwrc1:

Sequence; same for both SEQRES and ATOM records:

>d6hwrc1 b.1.12.0 (C:9-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d6hwrc1:

• d6hwrc1 first appeared in SCOPe 2.07