Lineage for d6hcwa2 (6hcw A:194-545)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (24 species)
    not a true protein
  7. 2532963Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries)
  8. 3067047Domain d6hcwa2: 6hcw A:194-545 [367109]
    Other proteins in same PDB: d6hcwa1, d6hcwa3, d6hcwb1, d6hcwb3
    automated match to d5elna2
    protein/RNA complex; complexed with fyb, lys, trs

Details for d6hcwa2

PDB Entry: 6hcw (more details), 1.46 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine and a difluoro cyclohexyl chromone ligand
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6hcwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcwa2 d.104.1.0 (A:194-545) automated matches {Cryptosporidium parvum [TaxId: 353152]}
dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar
pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy
mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie
sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii
dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd
veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn

SCOPe Domain Coordinates for d6hcwa2:

Click to download the PDB-style file with coordinates for d6hcwa2.
(The format of our PDB-style files is described here.)

Timeline for d6hcwa2:

  • d6hcwa2 is new in SCOPe 2.07-stable