Lineage for d6hcwa1 (6hcw A:46-193)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383832Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2383833Protein automated matches [190576] (50 species)
    not a true protein
  7. 2383871Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries)
  8. 3067046Domain d6hcwa1: 6hcw A:46-193 [367108]
    Other proteins in same PDB: d6hcwa2, d6hcwa3, d6hcwb2, d6hcwb3
    automated match to d5elna1
    protein/RNA complex; complexed with fyb, lys, trs

Details for d6hcwa1

PDB Entry: 6hcw (more details), 1.46 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine and a difluoro cyclohexyl chromone ligand
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6hcwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcwa1 b.40.4.0 (A:46-193) automated matches {Cryptosporidium parvum [TaxId: 353152]}
hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts
irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr
gelslfsksvvllspcyhmlptaisglk

SCOPe Domain Coordinates for d6hcwa1:

Click to download the PDB-style file with coordinates for d6hcwa1.
(The format of our PDB-style files is described here.)

Timeline for d6hcwa1:

  • d6hcwa1 is new in SCOPe 2.07-stable