Lineage for d6hcbb1 (6hcb B:3-262)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2485908Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2486152Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2486164Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)
  8. 3067043Domain d6hcbb1: 6hcb B:3-262 [367105]
    Other proteins in same PDB: d6hcbb2
    automated match to d4h8ja_
    complexed with cl, d45, glu, gol, peg, so4

Details for d6hcbb1

PDB Entry: 6hcb (more details), 1.9 Å

PDB Description: structure of glua2 ligand-binding domain (s1s2j-n775s) in complex with glutamate and tdpam01 at 1.9 a resolution.
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d6hcbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcbb1 c.94.1.1 (B:3-262) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d6hcbb1:

Click to download the PDB-style file with coordinates for d6hcbb1.
(The format of our PDB-style files is described here.)

Timeline for d6hcbb1:

  • d6hcbb1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6hcbb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6hcba_