SCOPe 2.07: Domain d6hwrb2: 6hwr B:121-432

Lineage for d6hwrb2 (6hwr B:121-432)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)

6. Protein automated matches [190524] (2 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (12 PDB entries)

8. Domain d6hwrb2: 6hwr B:121-432 [367101]
   Other proteins in same PDB: d6hwra1, d6hwrb1, d6hwrc1, d6hwrd1
   automated match to d1kbpa2
   complexed with edo, fe, fuc, gol, h1q, h1t, h1w, ipa, na, nag, pge, so4, vn3, vv6, zn

Details for d6hwrb2

PDB Entry: 6hwr, 1.95 Å

PDB Description: red kidney bean purple acid phosphatase in complex with adenosine divanadate

PDB Compounds: (B:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6hwrb2:

Sequence; same for both SEQRES and ATOM records:

>d6hwrb2 d.159.1.1 (B:121-432) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

Timeline for d6hwrb2:

• d6hwrb2 is new in SCOPe 2.07-stable
  
• d6hwrb2 appears in the current release, SCOPe 2.08