SCOPe 2.08: Domain d6hcha1: 6hch A:3-263

Lineage for d6hcha1 (6hch A:3-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)

8. Domain d6hcha1: 6hch A:3-263 [367097]
   Other proteins in same PDB: d6hcha2, d6hchb2, d6hchc2
   automated match to d4h8ja_
   complexed with act, cl, d45, glu, gol, so4, zn

Details for d6hcha1

PDB Entry: 6hch, 1.6 Å

PDB Description: structure of glua2 ligand-binding domain (s1s2j-l504y-n775s) in complex with glutamate and tdpam01 at 1.6 a resolution.

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d6hcha1:

Sequence; same for both SEQRES and ATOM records:

>d6hcha1 c.94.1.1 (A:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecgs

Timeline for d6hcha1:

• d6hcha1 first appeared in SCOPe 2.07