Lineage for d6hcwb2 (6hcw B:195-545)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. Protein automated matches [226887] (24 species)
    not a true protein
  7. Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries)
  8. Domain d6hcwb2: 6hcw B:195-545 [367093]
    Other proteins in same PDB: d6hcwa1, d6hcwa3, d6hcwb1, d6hcwb3
    automated match to d5elna2
    protein/RNA complex; complexed with fyb, lys, trs

Details for d6hcwb2

PDB Entry: 6hcw (more details), 1.46 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine and a difluoro cyclohexyl chromone ligand
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6hcwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcwb2 d.104.1.0 (B:195-545) automated matches {Cryptosporidium parvum [TaxId: 353152]}
qevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaarp
fityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefym
ayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeies
glgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfiid
hpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgdv
eacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn

SCOPe Domain Coordinates for d6hcwb2 are not available.

Timeline for d6hcwb2:

Domains from same chain:
(mouse over for more information)
d6hcwb1, d6hcwb3
Domains from other chains:
(mouse over for more information)
d6hcwa1, d6hcwa2, d6hcwa3