SCOPe 2.08: Domain d6hcwb2: 6hcw B:195-545

Lineage for d6hcwb2 (6hcw B:195-545)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries)

8. Domain d6hcwb2: 6hcw B:195-545 [367093]
   Other proteins in same PDB: d6hcwa1, d6hcwa3, d6hcwb1, d6hcwb3
   automated match to d5elna2
   protein/RNA complex; complexed with fyb, lys, trs

Details for d6hcwb2

PDB Entry: 6hcw, 1.46 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine and a difluoro cyclohexyl chromone ligand

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6hcwb2:

Sequence; same for both SEQRES and ATOM records:

>d6hcwb2 d.104.1.0 (B:195-545) automated matches {Cryptosporidium parvum [TaxId: 353152]}
qevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaarp
fityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefym
ayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeies
glgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfiid
hpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgdv
eacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn

Timeline for d6hcwb2:

• d6hcwb2 first appeared in SCOPe 2.07