Lineage for d6hcwb1 (6hcw B:46-189)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. Protein automated matches [190576] (52 species)
    not a true protein
  7. Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries)
  8. Domain d6hcwb1: 6hcw B:46-189 [367092]
    Other proteins in same PDB: d6hcwa2, d6hcwa3, d6hcwb2, d6hcwb3
    automated match to d5elna1
    protein/RNA complex; complexed with fyb, lys, trs

Details for d6hcwb1

PDB Entry: 6hcw (more details), 1.46 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine and a difluoro cyclohexyl chromone ligand
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6hcwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcwb1 b.40.4.0 (B:46-189) automated matches {Cryptosporidium parvum [TaxId: 353152]}
hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts
irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr
gelslfsksvvllspcyhmlptai

SCOPe Domain Coordinates for d6hcwb1 are not available.

Timeline for d6hcwb1:

Domains from same chain:
(mouse over for more information)
d6hcwb2, d6hcwb3
Domains from other chains:
(mouse over for more information)
d6hcwa1, d6hcwa2, d6hcwa3