Lineage for d6fvca1 (6fvc A:4-62)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305405Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2305406Protein automated matches [190674] (25 species)
    not a true protein
  7. 2305448Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [271176] (2 PDB entries)
  8. 3067021Domain d6fvca1: 6fvc A:4-62 [367083]
    Other proteins in same PDB: d6fvca2, d6fvca3
    automated match to d1ftta_
    mutant

Details for d6fvca1

PDB Entry: 6fvc (more details)

PDB Description: protein environment affects the water-tryptophan binding mode. molecular dynamics simulations of engrailed homeodomain mutants
PDB Compounds: (A:) Segmentation polarity homeobox protein engrailed

SCOPe Domain Sequences for d6fvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fvca1 a.4.1.0 (A:4-62) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnerakikks

SCOPe Domain Coordinates for d6fvca1:

Click to download the PDB-style file with coordinates for d6fvca1.
(The format of our PDB-style files is described here.)

Timeline for d6fvca1:

  • d6fvca1 is new in SCOPe 2.07-stable