Lineage for d6hccb1 (6hcc B:3-264)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)
  8. Domain d6hccb1: 6hcc B:3-264 [367079]
    Other proteins in same PDB: d6hcca2, d6hccb2
    automated match to d4h8ja_
    complexed with act, cl, fxw, glu, gol, peg, so4

Details for d6hccb1

PDB Entry: 6hcc (more details), 1.62 Å

PDB Description: structure of glua2 ligand-binding domain (s1s2j-n775s) in complex with glutamate and tdpam02 at 1.6 a resolution.
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d6hccb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hccb1 c.94.1.1 (B:3-264) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecgsg

SCOPe Domain Coordinates for d6hccb1 are not available.

Timeline for d6hccb1:

Domains from same chain:
(mouse over for more information)
d6hccb2
Domains from other chains:
(mouse over for more information)
d6hcca1, d6hcca2