Lineage for d6cw6d1 (6cw6 D:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757270Domain d6cw6d1: 6cw6 D:2-112 [367051]
    Other proteins in same PDB: d6cw6a1, d6cw6b_, d6cw6c2
    automated match to d3q5ya1
    complexed with nag, pbs, plm

Details for d6cw6d1

PDB Entry: 6cw6 (more details), 2.85 Å

PDB Description: structure of alpha-gc[8,18] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (D:) Chimeric T cell antigen receptor beta chain Vb8.2

SCOPe Domain Sequences for d6cw6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cw6d1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d6cw6d1:

Click to download the PDB-style file with coordinates for d6cw6d1.
(The format of our PDB-style files is described here.)

Timeline for d6cw6d1: