SCOPe 2.08: Domain d6cw6d1: 6cw6 D:2-112

Lineage for d6cw6d1 (6cw6 D:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6cw6d1: 6cw6 D:2-112 [367051]
   Other proteins in same PDB: d6cw6a1, d6cw6b_, d6cw6c2
   automated match to d3q5ya1
   complexed with nag, pbs, plm

Details for d6cw6d1

PDB Entry: 6cw6, 2.85 Å

PDB Description: structure of alpha-gc[8,18] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (D:) Chimeric T cell antigen receptor beta chain Vb8.2

SCOPe Domain Sequences for d6cw6d1:

Sequence; same for both SEQRES and ATOM records:

>d6cw6d1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

Timeline for d6cw6d1:

• d6cw6d1 first appeared in SCOPe 2.07