Lineage for d246l__ (246l -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein) Protein Phage T4 lysozyme [53982] (1 species) Species Bacteriophage T4 [TaxId:10665] [53983] (348 PDB entries) 
Domain d246l__: 246l - [36704]
Details for d246l__
PDB Entry: 246l (more details), 1.8 Å
PDB Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect
SCOP Domain Sequences for d246l__:
Sequence; same for both SEQRES and ATOM records: (download)
>d246l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklanqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
SCOP Domain Coordinates for d246l__:
Click to download the PDB-style file with coordinates for d246l__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d246l__:
- d246l__ first appeared (with stable ids) in SCOP 1.55
- d246l__ appears in SCOP 1.59
- d246l__ appears in the current release, SCOPe 2.08, called d246la_
View in 3D