Lineage for d6dyxd1 (6dyx D:1-116)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) 
Domain d6dyxd1: 6dyx D:1-116 [367024]
Other proteins in same PDB: d6dyxd2
automated match to d5ocld_
complexed with act, so4
Details for d6dyxd1
PDB Entry: 6dyx (more details), 1.5 Å
PDB Description: structure of vhh r419 isolated from a pre-immune phage display library
PDB Compounds: (D:) vhh r419SCOPe Domain Sequences for d6dyxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dyxd1 b.1.1.1 (D:1-116) automated matches {Vicugna pacos [TaxId: 30538]}
qvkleesggglvqaggslrlscaasgrtystyamgwfrqtpgkerelvaainwsggnthy
adsvkgrftisrdnakstvylqmnslkpedtavyycaapkghtgdhywgpgtqvtv
SCOPe Domain Coordinates for d6dyxd1:
Click to download the PDB-style file with coordinates for d6dyxd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6dyxd1:
- d6dyxd1 first appeared in SCOPe 2.07
View in 3D
