Lineage for d6dflb_ (6dfl B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316393Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2316394Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2316399Protein Acyl carrier protein [47338] (7 species)
  7. 2316405Species Escherichia coli [TaxId:562] [47339] (17 PDB entries)
    Uniprot P02901
  8. 3066959Domain d6dflb_: 6dfl B: [367021]
    automated match to d1t8ka_
    complexed with g9s

Details for d6dflb_

PDB Entry: 6dfl (more details), 2.4 Å

PDB Description: waap in complex with acyl carrier protein
PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d6dflb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dflb_ a.28.1.1 (B:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
tieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaek
ittvqaaidyin

SCOPe Domain Coordinates for d6dflb_:

Click to download the PDB-style file with coordinates for d6dflb_.
(The format of our PDB-style files is described here.)

Timeline for d6dflb_:

  • d6dflb_ appears in periodic updates to SCOPe 2.07 starting on 2019-04-04