SCOPe 2.07: Domain d6a72b_: 6a72 B:

Lineage for d6a72b_ (6a72 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.0: automated matches [191590] (1 protein)
   not a true family

6. Protein automated matches [191063] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254969] (13 PDB entries)

8. Domain d6a72b_: 6a72 B: [367002]
   automated match to d2gcfa_
   complexed with 9ux, ca

Details for d6a72b_

PDB Entry: 6a72, 2.1 Å

PDB Description: copper transporter protein

PDB Compounds: (B:) ATP7B protein

SCOPe Domain Sequences for d6a72b_:

Sequence; same for both SEQRES and ATOM records:

>d6a72b_ d.58.17.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcsttliaiagmtcascvhsiegmisqlegvqqisvslaegtatvlynpavispeelraa
iedmgfeasvvs

Timeline for d6a72b_:

• d6a72b_ is new in SCOPe 2.07-stable
  
• d6a72b_ appears in the current release, SCOPe 2.08