Lineage for d5yd6d_ (5yd6 D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Orphan nuclear receptor NURR1 [89142] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [89143] (3 PDB entries)
  8. Domain d5yd6d_: 5yd6 D: [366982]
    automated match to d1ovle_
    complexed with 8su, mg

Details for d5yd6d_

PDB Entry: 5yd6 (more details), 2.34 Å

PDB Description: crystal structure of pg-bound nurr1-lbd
PDB Compounds: (D:) Nuclear receptor subfamily 4 group A member 2

SCOPe Domain Sequences for d5yd6d_:

Sequence, based on SEQRES records: (download)

>d5yd6d_ a.123.1.1 (D:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
ppvslisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirg
waekipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgf
gewidsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhv
tfnngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

Sequence, based on observed residues (ATOM records): (download)

>d5yd6d_ a.123.1.1 (D:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
ppvslisalvrahvdsnpamtsldysrfqandtqhiqqfydlltgsmeiirgwaekipgf
adlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsiv
efssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnpnyl
skllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

SCOPe Domain Coordinates for d5yd6d_ are not available.

Timeline for d5yd6d_:

Domains from other chains:
(mouse over for more information)
d5yd6a_, d5yd6b_, d5yd6c_