Lineage for d5yd6a_ (5yd6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335562Protein Orphan nuclear receptor NURR1 [89142] (1 species)
  7. 2335563Species Human (Homo sapiens) [TaxId:9606] [89143] (3 PDB entries)
  8. 3066913Domain d5yd6a_: 5yd6 A: [366975]
    automated match to d1ovle_
    complexed with 8su, mg

Details for d5yd6a_

PDB Entry: 5yd6 (more details), 2.34 Å

PDB Description: crystal structure of pg-bound nurr1-lbd
PDB Compounds: (A:) Nuclear receptor subfamily 4 group A member 2

SCOPe Domain Sequences for d5yd6a_:

Sequence, based on SEQRES records: (download)

>d5yd6a_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
vslisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirgwa
ekipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfge
widsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtf
nngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

Sequence, based on observed residues (ATOM records): (download)

>d5yd6a_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
vslisalvrahvdsnpamtsldysrfqanpddtqhiqqfydlltgsmeiirgwaekipgf
adlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsiv
efssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfpnylsk
llgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

SCOPe Domain Coordinates for d5yd6a_:

Click to download the PDB-style file with coordinates for d5yd6a_.
(The format of our PDB-style files is described here.)

Timeline for d5yd6a_:

  • d5yd6a_ is new in SCOPe 2.07-stable