Lineage for d5yd6c_ (5yd6 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2341814Protein Orphan nuclear receptor NURR1 [89142] (1 species)
  7. 2341815Species Human (Homo sapiens) [TaxId:9606] [89143] (3 PDB entries)
  8. 2341826Domain d5yd6c_: 5yd6 C: [366970]
    automated match to d1ovle_
    complexed with 8su, mg

Details for d5yd6c_

PDB Entry: 5yd6 (more details), 2.34 Å

PDB Description: crystal structure of pg-bound nurr1-lbd
PDB Compounds: (C:) Nuclear receptor subfamily 4 group A member 2

SCOPe Domain Sequences for d5yd6c_:

Sequence, based on SEQRES records: (download)

>d5yd6c_ a.123.1.1 (C:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
ppvslisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirg
waekipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgf
gewidsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhv
tfnngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

Sequence, based on observed residues (ATOM records): (download)

>d5yd6c_ a.123.1.1 (C:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
ppvslisalvrahvdsnpamtsldysrfqandtqhiqqfydlltgsmeiirgwaekipgf
adlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsiv
efssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnpnyl
skllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

SCOPe Domain Coordinates for d5yd6c_:

Click to download the PDB-style file with coordinates for d5yd6c_.
(The format of our PDB-style files is described here.)

Timeline for d5yd6c_: