Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Chlamydia trachomatis [TaxId:471473] [364686] (3 PDB entries) |
Domain d6o3fa2: 6o3f A:164-520 [366966] Other proteins in same PDB: d6o3fa1, d6o3fb1 automated match to d3a74a2 protein/RNA complex; complexed with edo, fyb, lys, peg, pg4, so4 |
PDB Entry: 6o3f (more details), 2.4 Å
SCOPe Domain Sequences for d6o3fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o3fa2 d.104.1.0 (A:164-520) automated matches {Chlamydia trachomatis [TaxId: 471473]} khagladkeiryrkrwadlissedvrktfltrsrilklireymdqqsflevetpilqtvy ggaeatpfvttlqalhaemflrisleialkkllvggmsrvyeigkvfrnegidrthnpef tmieayaaywdyndvmkcvenlveyivralnngetqvqyshlksgpqvvdfkapwirmtm kesisvyggvdvdlhadhelrkiletqtslpektyvhasrgeliallfdelvcdkliaph hitdhplettplcktlrsgdetlverfesfclgkelcnayselndplqqrklleeqmrkk alnpdseyhpideeflealcqgmppaggfgigidrlvmmltdaasirdvlffpvmrr
Timeline for d6o3fa2: