Lineage for d6o3fa2 (6o3f A:164-520)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574631Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2574632Protein automated matches [226887] (24 species)
    not a true protein
  7. 2574651Species Chlamydia trachomatis [TaxId:471473] [364686] (3 PDB entries)
  8. 2574656Domain d6o3fa2: 6o3f A:164-520 [366966]
    Other proteins in same PDB: d6o3fa1, d6o3fb1
    automated match to d3a74a2
    protein/RNA complex; complexed with edo, fyb, lys, peg, pg4, so4

Details for d6o3fa2

PDB Entry: 6o3f (more details), 2.4 Å

PDB Description: crystal structure of lysyl-trna synthetase from chlamydia trachomatis with complexed with l-lysine and a difluoro cyclohexyl chromone ligand
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6o3fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o3fa2 d.104.1.0 (A:164-520) automated matches {Chlamydia trachomatis [TaxId: 471473]}
khagladkeiryrkrwadlissedvrktfltrsrilklireymdqqsflevetpilqtvy
ggaeatpfvttlqalhaemflrisleialkkllvggmsrvyeigkvfrnegidrthnpef
tmieayaaywdyndvmkcvenlveyivralnngetqvqyshlksgpqvvdfkapwirmtm
kesisvyggvdvdlhadhelrkiletqtslpektyvhasrgeliallfdelvcdkliaph
hitdhplettplcktlrsgdetlverfesfclgkelcnayselndplqqrklleeqmrkk
alnpdseyhpideeflealcqgmppaggfgigidrlvmmltdaasirdvlffpvmrr

SCOPe Domain Coordinates for d6o3fa2:

Click to download the PDB-style file with coordinates for d6o3fa2.
(The format of our PDB-style files is described here.)

Timeline for d6o3fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6o3fa1