SCOPe 2.08: Domain d6qmmb_: 6qmm B:

Lineage for d6qmmb_ (6qmm B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:1140] [366961] (1 PDB entry)

8. Domain d6qmmb_: 6qmm B: [366962]
   automated match to d3o4ff_
   complexed with mta, put, pxn, spd

Details for d6qmmb_

PDB Entry: 6qmm, 2.18 Å

PDB Description: crystal structure of synecochoccus spermidine synthase in complex with putrescine, spermidine and mta

PDB Compounds: (B:) Polyamine Aminopropyltransferase

SCOPe Domain Sequences for d6qmmb_:

Sequence; same for both SEQRES and ATOM records:

>d6qmmb_ c.66.1.0 (B:) automated matches {Synechococcus elongatus [TaxId: 1140]}
pvwidevfedrvryglrgqilweetspfqkitivdtehygrglllddcwmtaercevcyh
eylvhpplttaasiarvlvigggdggtvrevlryaeveqvdlveidgrvvelsqeylgai
gtawadprlnvkigdgiafvqtapdasydvilvdgsdpagpaaglfnrefyencrrvlkp
ggvfasqaespdsflavhlemietlsavfaeakpyygwvpmypsgwwswlyasdtpgqfq
kpqsdrlaaiepqveiynrdihqaafaqpnfvrrglsarq

Timeline for d6qmmb_:

• d6qmmb_ first appeared in SCOPe 2.07