SCOPe 2.08: Domain d6r2sa1: 6r2s A:20-125

Lineage for d6r2sa1 (6r2s A:20-125)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6r2sa1: 6r2s A:20-125 [366952]
   Other proteins in same PDB: d6r2sa2, d6r2sc1, d6r2sc2
   automated match to d1dn0a1

Details for d6r2sa1

PDB Entry: 6r2s, 3.04 Å

PDB Description: the structure of plasmodium vivax duffy binding protein (pvdbp) bound to human antibody db9

PDB Compounds: (A:) Antibody DB9 light chain

SCOPe Domain Sequences for d6r2sa1:

Sequence; same for both SEQRES and ATOM records:

>d6r2sa1 b.1.1.0 (A:20-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspstlsasvgdrvtitcrasqsisswlawyqqrpgkaprlliykassllsgvps
rfggsgsgtdftltisslqpddfatyhcqhyntypwtfgqgtkvei

Timeline for d6r2sa1:

• d6r2sa1 first appeared in SCOPe 2.07