SCOPe 2.08: Domain d6mtol1: 6mto L:1-105

Lineage for d6mtol1 (6mto L:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6mtol1: 6mto L:1-105 [366948]
   Other proteins in same PDB: d6mtot1, d6mtot2
   automated match to d3u7wl1

Details for d6mtol1

PDB Entry: 6mto, 2.63 Å

PDB Description: crystal structure of vrc42.01 fab in complex with t117-f mper scaffold

PDB Compounds: (L:) Antibody VRC42.01 Fab light chain

SCOPe Domain Sequences for d6mtol1:

Sequence; same for both SEQRES and ATOM records:

>d6mtol1 b.1.1.0 (L:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspdtlslspgeraslscrasqnvrnsnlawyqhkpgqpprlliygassrasgip
grfsgsgsgtdftltisrlepedfavyycqqyggsfgtfgqgtkve

Timeline for d6mtol1:

• d6mtol1 first appeared in SCOPe 2.07