SCOPe 2.08: Domain d6r2sc1: 6r2s C:211-507

Lineage for d6r2sc1 (6r2s C:211-507)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
   consist of two subdomains, each containing a three-helical bundle

4. Superfamily a.264.1: Duffy binding domain-like [140924] (2 families)
   automatically mapped to Pfam PF05424

5. Family a.264.1.1: Duffy binding domain [140925] (3 proteins)
   Pfam PF05424

6. Protein automated matches [191262] (2 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:126793] [189825] (5 PDB entries)

8. Domain d6r2sc1: 6r2s C:211-507 [366945]
   Other proteins in same PDB: d6r2sa1, d6r2sa2, d6r2sc2
   automated match to d4nuvb_

Details for d6r2sc1

PDB Entry: 6r2s, 3.04 Å

PDB Description: the structure of plasmodium vivax duffy binding protein (pvdbp) bound to human antibody db9

PDB Compounds: (C:) Duffy receptor

SCOPe Domain Sequences for d6r2sc1:

Sequence; same for both SEQRES and ATOM records:

>d6r2sc1 a.264.1.1 (C:211-507) automated matches {Plasmodium vivax [TaxId: 126793]}
ntvmkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlvnntdtnfhrditfrkl
ylkrkliydaavegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvven
nlrsifgtdekaqqrrkqwwneskaqiwtammysvkkrlkgnfiwicklnvavniepqiy
rwirewgrdyvselptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqw
dvlsnkfisvknaekvqtagivtpydilkqeldefnevafeneinkrdgayielcvc

Timeline for d6r2sc1:

• d6r2sc1 first appeared in SCOPe 2.07