SCOPe 2.08: Domain d6o3fb2: 6o3f B:164-521

Lineage for d6o3fb2 (6o3f B:164-521)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:471473] [364686] (3 PDB entries)

8. Domain d6o3fb2: 6o3f B:164-521 [366942]
   Other proteins in same PDB: d6o3fa1, d6o3fb1
   automated match to d3a74a2
   protein/RNA complex; complexed with edo, fyb, lys, peg, pg4, so4

Details for d6o3fb2

PDB Entry: 6o3f, 2.4 Å

PDB Description: crystal structure of lysyl-trna synthetase from chlamydia trachomatis with complexed with l-lysine and a difluoro cyclohexyl chromone ligand

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6o3fb2:

Sequence; same for both SEQRES and ATOM records:

>d6o3fb2 d.104.1.0 (B:164-521) automated matches {Chlamydia trachomatis [TaxId: 471473]}
khagladkeiryrkrwadlissedvrktfltrsrilklireymdqqsflevetpilqtvy
ggaeatpfvttlqalhaemflrisleialkkllvggmsrvyeigkvfrnegidrthnpef
tmieayaaywdyndvmkcvenlveyivralnngetqvqyshlksgpqvvdfkapwirmtm
kesisvyggvdvdlhadhelrkiletqtslpektyvhasrgeliallfdelvcdkliaph
hitdhplettplcktlrsgdetlverfesfclgkelcnayselndplqqrklleeqmrkk
alnpdseyhpideeflealcqgmppaggfgigidrlvmmltdaasirdvlffpvmrri

Timeline for d6o3fb2:

• d6o3fb2 first appeared in SCOPe 2.07