Lineage for d6hmqa_ (6hmq A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)
  8. 3066859Domain d6hmqa_: 6hmq A: [366921]
    automated match to d5nqca_
    complexed with 4b0, cl, edo, na, trs

Details for d6hmqa_

PDB Entry: 6hmq (more details), 0.97 Å

PDB Description: structure of protein kinase ck2 catalytic subunit (isoform ck2alpha'; csnk2a2 gene product) in complex with the benzotriazole-type inhibitor mb002
PDB Compounds: (A:) Casein kinase II subunit alpha'

SCOPe Domain Sequences for d6hmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hmqa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevfeainitnnerv
vvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqly
qiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpa
qeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvri
akvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkll
rydhqqrltakeamehpyfypvvkeqs

SCOPe Domain Coordinates for d6hmqa_:

Click to download the PDB-style file with coordinates for d6hmqa_.
(The format of our PDB-style files is described here.)

Timeline for d6hmqa_:

  • d6hmqa_ is new in SCOPe 2.07-stable