Lineage for d6hkvc_ (6hkv C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823225Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2823226Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2823296Protein automated matches [191200] (13 species)
    not a true protein
  7. 2823611Species Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909] [275642] (6 PDB entries)
  8. 2823649Domain d6hkvc_: 6hkv C: [366908]
    automated match to d4u62a_
    complexed with cl, gol, gxb, mg

Details for d6hkvc_

PDB Entry: 6hkv (more details), 1.75 Å

PDB Description: trichodysplasia spinulosa-associated polyomavirus (tspyv) vp1 in complex with sialylated precision glycooligomers
PDB Compounds: (C:) Capsid protein VP1

SCOPe Domain Sequences for d6hkvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hkvc_ b.121.6.1 (C:) automated matches {Trichodysplasia spinulosa-associated polyomavirus [TaxId: 862909]}
nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
ivgflvgkdgdmqyrglpryfnillrkrtvrn

SCOPe Domain Coordinates for d6hkvc_:

Click to download the PDB-style file with coordinates for d6hkvc_.
(The format of our PDB-style files is described here.)

Timeline for d6hkvc_: