SCOPe 2.07: Domain d6n69b2: 6n69 B:76-199

Lineage for d6n69b2 (6n69 B:76-199)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47630] (3 PDB entries)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d6n69b2: 6n69 B:76-199 [366902]
   Other proteins in same PDB: d6n69a1, d6n69b1
   automated match to d1pd211
   complexed with gsh, kdv

Details for d6n69b2

PDB Entry: 6n69, 2 Å

PDB Description: rat hpgds complexed with a quinoline

PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d6n69b2:

Sequence; same for both SEQRES and ATOM records:

>d6n69b2 a.45.1.1 (B:76-199) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

Timeline for d6n69b2:

• d6n69b2 is new in SCOPe 2.07-stable
  
• d6n69b2 appears in the current release, SCOPe 2.08