SCOPe 2.06: Domain d1lyga_: 1lyg A:

Lineage for d1lyga_ (1lyg A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d1lyga_: 1lyg A: [36689]
   complexed with bme, cl

Details for d1lyga_

PDB Entry: 1lyg, 1.8 Å

PDB Description: dissection of helix capping in t4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at thr 59

PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d1lyga_:

Sequence; same for both SEQRES and ATOM records:

>d1lyga_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvink
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d1lyga_:

• d1lyga_ first appeared (with stable ids) in SCOP 1.55, called d1lyg__
  
• d1lyga_ appears in SCOPe 2.05
  
• d1lyga_ appears in SCOPe 2.07
  
• d1lyga_ appears in the current release, SCOPe 2.08