Lineage for d6hmda_ (6hmd A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein automated matches [190091] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188447] (844 PDB entries)
  8. Domain d6hmda_: 6hmd A: [366877]
    automated match to d5nqca_
    complexed with cl, edo, gdw

Details for d6hmda_

PDB Entry: 6hmd (more details), 1 Å

PDB Description: structure of protein kinase ck2 catalytic subunit (isoform ck2alpha'; csnk2a2 gene product) in complex with the indenoindole-type inhibitor ar18
PDB Compounds: (A:) Casein kinase II subunit alpha'

SCOPe Domain Sequences for d6hmda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hmda_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevfeainitnnerv
vvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqly
qiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpa
qeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvri
akvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkll
rydhqqrltakeamehpyfypvvkeqsq

SCOPe Domain Coordinates for d6hmda_ are not available.

Timeline for d6hmda_: