Lineage for d6gvcb1 (6gvc B:5-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491252Protein Actin [53073] (10 species)
  7. 2491291Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2491464Domain d6gvcb1: 6gvc B:5-146 [366860]
    Other proteins in same PDB: d6gvcr_
    automated match to d1esva1
    complexed with atp, edo, lab, mg

Details for d6gvcb1

PDB Entry: 6gvc (more details), 2.6 Å

PDB Description: structure of arhgap12 bound to g-actin
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6gvcb1:

Sequence, based on SEQRES records: (download)

>d6gvcb1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d6gvcb1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgii
tnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvai
qavlslyasg

SCOPe Domain Coordinates for d6gvcb1:

Click to download the PDB-style file with coordinates for d6gvcb1.
(The format of our PDB-style files is described here.)

Timeline for d6gvcb1: