SCOPe 2.08: Domain d6gvcb1: 6gvc B:5-146

Lineage for d6gvcb1 (6gvc B:5-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d6gvcb1: 6gvc B:5-146 [366860]
   Other proteins in same PDB: d6gvcr_
   automated match to d1esva1
   complexed with atp, edo, lab, mg

Details for d6gvcb1

PDB Entry: 6gvc, 2.6 Å

PDB Description: structure of arhgap12 bound to g-actin

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6gvcb1:

Sequence, based on SEQRES records:

>d6gvcb1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d6gvcb1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgii
tnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvai
qavlslyasg

Timeline for d6gvcb1:

• d6gvcb1 first appeared in SCOPe 2.07