SCOPe 2.08: Domain d237la_: 237l A:

Lineage for d237la_ (237l A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d237la_: 237l A: [36686]
   complexed with cl, hed

Details for d237la_

PDB Entry: 237l, 1.7 Å

PDB Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect

PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d237la_:

Sequence; same for both SEQRES and ATOM records:

>d237la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakraittfrtgtwdayknl

Timeline for d237la_:

• d237la_ first appeared (with stable ids) in SCOP 1.55, called d237l__
  
• d237la_ appears in SCOPe 2.07