Lineage for d6fwbc2 (6fwb C:131-251)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976515Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. 2976568Domain d6fwbc2: 6fwb C:131-251 [366857]
    automated match to d2hj2a2
    complexed with gol, na, pg4, so4

Details for d6fwbc2

PDB Entry: 6fwb (more details), 1.79 Å

PDB Description: crystal structure of mat2a at 1.79 angstron resolution
PDB Compounds: (C:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d6fwbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fwbc2 d.130.1.0 (C:131-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvtvqymq
drgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlqpsgrf
v

SCOPe Domain Coordinates for d6fwbc2:

Click to download the PDB-style file with coordinates for d6fwbc2.
(The format of our PDB-style files is described here.)

Timeline for d6fwbc2: