SCOPe 2.06: Domain d131la_: 131l A:

Lineage for d131la_ (131l A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d131la_: 131l A: [36685]
   complexed with bme, cl; mutant

Details for d131la_

PDB Entry: 131l, 1.7 Å

PDB Description: structures of randomly generated mutants of t4 lysozyme show that protein stability can be enhanced by relaxation of strain and by improved hydrogen bonding via bound solvent

PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d131la_:

Sequence; same for both SEQRES and ATOM records:

>d131la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyysigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d131la_:

• d131la_ first appeared (with stable ids) in SCOP 1.55, called d131l__
  
• d131la_ appears in SCOPe 2.05
  
• d131la_ appears in SCOPe 2.07
  
• d131la_ appears in the current release, SCOPe 2.08