Lineage for d6h19a1 (6h19 A:2-533)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2899461Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2899847Protein automated matches [190065] (7 species)
    not a true protein
  7. 2899853Species Human (Homo sapiens) [TaxId:9606] [186857] (44 PDB entries)
  8. 2899869Domain d6h19a1: 6h19 A:2-533 [366836]
    Other proteins in same PDB: d6h19a2
    automated match to d1f6wa_
    complexed with act, na, sdp, zn

Details for d6h19a1

PDB Entry: 6h19 (more details), 1.89 Å

PDB Description: crystal structure of ethyl-paraoxon inhibited recombinant human bile salt activated lipase (aged form)
PDB Compounds: (A:) Bile salt-activated lipase

SCOPe Domain Sequences for d6h19a1:

Sequence, based on SEQRES records: (download)

>d6h19a1 c.69.1.1 (A:2-533) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpqphpgwqgtlkaknfk
krclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyggaflmgsghganfln
nylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrdqhmaiawvkrniaaf
ggdpdnitlfgesaggasvslqtlspynkglirraisqsgvalspwviqknplfwakkva
ekvgcpvgdaarmaqclkvtdpraltlaykvplagleypmlhyvgfvpvidgdfipddpi
nlyanaadidyiagtnnmdghifasidmpainkgnkkvteedfyklvseftitkglrgak
ttfdvyteswaqdpsqenkkktvvdfetdvlflvpteialaqhranaksaktyaylfshp
srmpvypkwvgadhaddiqyvfgkpfatptgyrpqdrtvskamiaywtnfaktgdpnmgd
savpthwepyttensgyleitkkmgsssmkrslrtnflrywtltylalptvt

Sequence, based on observed residues (ATOM records): (download)

>d6h19a1 c.69.1.1 (A:2-533) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpqphpgwqgtlkaknfk
krclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyggaflmgsghganfln
nylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrdqhmaiawvkrniaaf
ggdpdnitlfgesaggasvslqtlspynkglirraisqsgvalspwviqknplfwakkva
ekvgcpvgdaarmaqclkvtdpraltlaykvplagleypmlhyvgfvpvidgdfipddpi
nlyanaadidyiagtnnmdghifasidmpainkgnkkvteedfyklvseftitkglrgak
ttfdvyteswaqdpsqenkkktvvdfetdvlflvpteialaqhranaksaktyaylfshp
adhaddiqyvfgkpfatptgyrpqdrtvskamiaywtnfaktgdpnmgdsavpthwepyt
tensgyleitkkmgsssmkrslrtnflrywtltylalptvt

SCOPe Domain Coordinates for d6h19a1:

Click to download the PDB-style file with coordinates for d6h19a1.
(The format of our PDB-style files is described here.)

Timeline for d6h19a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h19a2