Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909] [275642] (6 PDB entries) |
Domain d6hkve_: 6hkv E: [366833] automated match to d4u62a_ complexed with cl, gol, gxb, mg |
PDB Entry: 6hkv (more details), 1.75 Å
SCOPe Domain Sequences for d6hkve_:
Sequence, based on SEQRES records: (download)
>d6hkve_ b.121.6.1 (E:) automated matches {Trichodysplasia spinulosa-associated polyomavirus [TaxId: 862909]} ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys tarinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmn fhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpve cwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdi vgflvgkdgdmqyrglpryfnillrkrtvrn
>d6hkve_ b.121.6.1 (E:) automated matches {Trichodysplasia spinulosa-associated polyomavirus [TaxId: 862909]} ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys tarinlpmlnntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfa vggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpd psknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflv gkdgdmqyrglpryfnillrkrtvrn
Timeline for d6hkve_: