Lineage for d6ehja1 (6ehj A:115-295)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. Protein automated matches [190038] (49 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. Domain d6ehja1: 6ehj A:115-295 [366828]
    automated match to d3iu1a1
    complexed with asn, coa, gly, gol, lys, mya, myr, pro, ser

Details for d6ehja1

PDB Entry: 6ehj (more details), 2.1 Å

PDB Description: human n-myristoyltransferase (nmt1) with myristoyl-coa and peptide bound
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d6ehja1:

Sequence, based on SEQRES records: (download)

>d6ehja1 d.108.1.0 (A:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
r

Sequence, based on observed residues (ATOM records): (download)

>d6ehja1 d.108.1.0 (A:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvdnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihiyd
tekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcr

SCOPe Domain Coordinates for d6ehja1 are not available.

Timeline for d6ehja1:

Domains from same chain:
(mouse over for more information)
d6ehja2
Domains from other chains:
(mouse over for more information)
d6ehjb1, d6ehjb2