Lineage for d6hkvg_ (6hkv G:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. Protein automated matches [191200] (13 species)
    not a true protein
  7. Species Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909] [275642] (6 PDB entries)
  8. Domain d6hkvg_: 6hkv G: [366825]
    automated match to d4u62a_
    complexed with cl, gol, gxb, mg

Details for d6hkvg_

PDB Entry: 6hkv (more details), 1.7500000000000002 Å

PDB Description: trichodysplasia spinulosa-associated polyomavirus (tspyv) vp1 in complex with sialylated precision glycooligomers
PDB Compounds: (G:) Capsid protein VP1

SCOPe Domain Sequences for d6hkvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hkvg_ b.121.6.1 (G:) automated matches {Trichodysplasia spinulosa-associated polyomavirus [TaxId: 862909]}
ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
tarinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmn
fhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpve
cwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdi
vgflvgkdgdmqyrglpryfnillrkrtvrn

SCOPe Domain Coordinates for d6hkvg_ are not available.

Timeline for d6hkvg_:

Domains from other chains:
(mouse over for more information)
d6hkva_, d6hkvb_, d6hkvc_, d6hkvd_, d6hkve_, d6hkvf_, d6hkvh_, d6hkvi_, d6hkvj_