![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) ![]() |
![]() | Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
![]() | Protein automated matches [191200] (13 species) not a true protein |
![]() | Species Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909] [275642] (6 PDB entries) |
![]() | Domain d6hkvf_: 6hkv F: [366816] automated match to d4u62a_ complexed with cl, gol, gxb, mg |
PDB Entry: 6hkv (more details), 1.75 Å
SCOPe Domain Sequences for d6hkvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hkvf_ b.121.6.1 (F:) automated matches {Trichodysplasia spinulosa-associated polyomavirus [TaxId: 862909]} nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd ivgflvgkdgdmqyrglpryfnillrkrtvrn
Timeline for d6hkvf_: