SCOPe 2.07: Domain d6ecpa1: 6ecp A:2-126

Lineage for d6ecpa1 (6ecp A:2-126)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
   automatically mapped to Pfam PF00763

6. Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
   the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated

7. Species Human (Homo sapiens) [TaxId:9606] [53237] (7 PDB entries)

8. Domain d6ecpa1: 6ecp A:2-126 [366814]
   Other proteins in same PDB: d6ecpa2, d6ecpb2
   automated match to d1diga2
   complexed with 21v, nap

Details for d6ecpa1

PDB Entry: 6ecp, 2.2 Å

PDB Description: the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp and inhibitor ly249543

PDB Compounds: (A:) methylenetetrahydrofolate dehydrogenase cyclohydrolase

SCOPe Domain Sequences for d6ecpa1:

Sequence; same for both SEQRES and ATOM records:

>d6ecpa1 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

Timeline for d6ecpa1:

• d6ecpa1 is new in SCOPe 2.07-stable
  
• d6ecpa1 appears in the current release, SCOPe 2.08