![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.12: TrpR-like [48295] (4 families) ![]() contains an extra shared helix after the HTH motif |
![]() | Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins) intertwined dimer of identical 6-helical subunits automatically mapped to Pfam PF01371 |
![]() | Protein automated matches [254650] (4 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83334] [340663] (7 PDB entries) |
![]() | Domain d6f7fb_: 6f7f B: [366789] automated match to d5tm0a_ complexed with iop |
PDB Entry: 6f7f (more details), 2.13 Å
SCOPe Domain Sequences for d6f7fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f7fb_ a.4.12.1 (B:) automated matches {Escherichia coli [TaxId: 83334]} qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr gemsqrelknelgagiatitrgsnslkaapvelrqwleevll
Timeline for d6f7fb_: