Lineage for d6fwxa1 (6fwx A:1-100)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (29 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 3066719Domain d6fwxa1: 6fwx A:1-100 [366781]
    automated match to d2a38a1
    complexed with edo

Details for d6fwxa1

PDB Entry: 6fwx (more details), 3 Å

PDB Description: chimeric titin z1z2-z1z2 tandem (z1212) functionalized with a grgds exogenous peptide from fibronectin
PDB Compounds: (A:) Titin,Titin,Titin

SCOPe Domain Sequences for d6fwxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fwxa1 b.1.1.0 (A:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
grakltipavtkansgryslkatngsgqatstaellvkae

SCOPe Domain Coordinates for d6fwxa1:

Click to download the PDB-style file with coordinates for d6fwxa1.
(The format of our PDB-style files is described here.)

Timeline for d6fwxa1:

  • d6fwxa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6fwxa2