![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
![]() | Protein automated matches [226932] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [366768] (1 PDB entry) |
![]() | Domain d6gvcr_: 6gvc R: [366769] Other proteins in same PDB: d6gvca1, d6gvca2, d6gvcb1, d6gvcb2, d6gvcc1, d6gvcc2, d6gvcd1, d6gvcd2 automated match to d3byic_ complexed with atp, edo, lab, mg |
PDB Entry: 6gvc (more details), 2.6 Å
SCOPe Domain Sequences for d6gvcr_:
Sequence, based on SEQRES records: (download)
>d6gvcr_ a.116.1.0 (R:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qkktkknlkkfltrrptlqavrekgyikdqvfgsnlanlcqrengtvpkfvklciehvee hgldvdgiyrvsgnlaviqklrfavnhdekldlndskwedihvitgalkmffrelpeplf tfnhfndfvnaikqeprqrvtavkdlirqlpkpnqdtmqilfrhlkrviengeknrmtyq siaivfgptllkperetgniavhtvyqnqivelillelstvfg
>d6gvcr_ a.116.1.0 (R:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qkktkknlkkfltrrptlqavrekgyikdqvfgsnlanlcqrengtvpkfvklciehvee hgldvdgiyrvsgnlaviqklrfavnhdekldlndskwedihvitgalkmffrelpeplf tfnhfndfvnaikqeprqrvtavkdlirqlpkpnqdtmqilfrhlkrviengeknrmtyq siaivfgptllkperhtvyqnqivelillelstvfg
Timeline for d6gvcr_: