Lineage for d6fwxb1 (6fwx B:103-194)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (29 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 3066703Domain d6fwxb1: 6fwx B:103-194 [366765]
    automated match to d2a38a2
    complexed with edo

Details for d6fwxb1

PDB Entry: 6fwx (more details), 3 Å

PDB Description: chimeric titin z1z2-z1z2 tandem (z1212) functionalized with a grgds exogenous peptide from fibronectin
PDB Compounds: (B:) Titin,Titin,Titin

SCOPe Domain Sequences for d6fwxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fwxb1 b.1.1.0 (B:103-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppnfvqrlqsmtvrqgsqvrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlysll
iaeaypedsgtysvnatnsvgratstaellvq

SCOPe Domain Coordinates for d6fwxb1:

Click to download the PDB-style file with coordinates for d6fwxb1.
(The format of our PDB-style files is described here.)

Timeline for d6fwxb1:

  • d6fwxb1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6fwxb2