Lineage for d6e91a_ (6e91 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. Protein Carbonic anhydrase [51071] (10 species)
  7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (966 PDB entries)
    Uniprot P00918
  8. Domain d6e91a_: 6e91 A: [366763]
    automated match to d4r5aa_
    complexed with j04, zn

Details for d6e91a_

PDB Entry: 6e91 (more details), 1.8 Å

PDB Description: ca ix mimic complexed with steroidal sulfamate compound stx 2484
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d6e91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e91a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d6e91a_ are not available.

Timeline for d6e91a_: