Lineage for d6fz3a2 (6fz3 A:296-496)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969160Domain d6fz3a2: 6fz3 A:296-496 [366756]
    Other proteins in same PDB: d6fz3a3
    automated match to d3iu1a2
    complexed with ebk, gol, mg, mya

Details for d6fz3a2

PDB Entry: 6fz3 (more details), 2 Å

PDB Description: human n-myristoyltransferase (nmt1) with myristoyl-coa and inhibitor bound
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d6fz3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fz3a2 d.108.1.0 (A:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvglvlq

SCOPe Domain Coordinates for d6fz3a2:

Click to download the PDB-style file with coordinates for d6fz3a2.
(The format of our PDB-style files is described here.)

Timeline for d6fz3a2: