![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries) |
![]() | Domain d6fz3b1: 6fz3 B:115-295 [366750] Other proteins in same PDB: d6fz3a3 automated match to d3iu1a1 complexed with ebk, gol, mg, mya |
PDB Entry: 6fz3 (more details), 2 Å
SCOPe Domain Sequences for d6fz3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fz3b1 d.108.1.0 (B:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc r
Timeline for d6fz3b1: