Lineage for d6ecrb2 (6ecr B:127-296)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453840Protein automated matches [227005] (6 species)
    not a true protein
  7. 2453900Species Homo sapiens [TaxId:9606] [353659] (4 PDB entries)
  8. 2453901Domain d6ecrb2: 6ecr B:127-296 [366748]
    Other proteins in same PDB: d6ecra1, d6ecra2, d6ecrb1
    automated match to d1a4ia1
    complexed with act, nap

Details for d6ecrb2

PDB Entry: 6ecr (more details), 2.2 Å

PDB Description: the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp
PDB Compounds: (B:) methylenetetrahydrofolate dehydrogenase cyclohydrolase

SCOPe Domain Sequences for d6ecrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ecrb2 c.2.1.7 (B:127-296) automated matches {Homo sapiens [TaxId: 9606]}
ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll
wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpddkk
pngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle

SCOPe Domain Coordinates for d6ecrb2:

Click to download the PDB-style file with coordinates for d6ecrb2.
(The format of our PDB-style files is described here.)

Timeline for d6ecrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ecrb1