SCOPe 2.08: Domain d6ecrb2: 6ecr B:127-296

Lineage for d6ecrb2 (6ecr B:127-296)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
   the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated

7. Species Human (Homo sapiens) [TaxId:9606] [51895] (7 PDB entries)

8. Domain d6ecrb2: 6ecr B:127-296 [366748]
   Other proteins in same PDB: d6ecra1, d6ecrb1
   automated match to d1a4ia1
   complexed with act, nap
   missing some secondary structures that made up less than one-third of the common domain

Details for d6ecrb2

PDB Entry: 6ecr, 2.2 Å

PDB Description: the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp

PDB Compounds: (B:) methylenetetrahydrofolate dehydrogenase cyclohydrolase

SCOPe Domain Sequences for d6ecrb2:

Sequence; same for both SEQRES and ATOM records:

>d6ecrb2 c.2.1.7 (B:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]}
ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll
wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpddkk
pngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle

Timeline for d6ecrb2:

• d6ecrb2 first appeared in SCOPe 2.07